Search

Filter

sports 53
Sorry, no results
found for "sports" on the website

tutorials

blog

Get Started with "Add to Samsung Wallet"

introduction smartphones have become an essential part of our everyday lives. users are continually searching for more convenient ways to perform their tasks on their smartphones, driving them toward services with greater usability. as smartphones advance, our lives become simpler. galaxy users have completely embraced the convenience of paying with samsung pay, and no longer carry physical payment cards. this led to the evolution of samsung pay into samsung wallet, incorporating biometric-authentication-based security solutions and adding various features to replace conventional wallets. since june 2022, samsung wallet has been expanding its service area based on the existing samsung pay launching countries. this article aims to introduce samsung wallet and guide you through the integration process of the "add to samsung wallet" feature, which allows you to digitize various content and offer them as wallet cards. notice this article introduces non-payment service cards. if you want to learn more about the payment service of samsung wallet, visit the samsung pay page. you can get information on online payment services such as in-app payments, web checkout, and w3c payments. add to samsung wallet service let's delve deeper into the "add to samsung wallet" feature. digitized content registered in samsung wallet comes in the form of cards called wallet cards. registering a wallet card is effortless: simply click the "add to samsung wallet" button, and the card is stored securely on users’ galaxy smartphones. "add to samsung wallet" button and wallet card notice the benefits of using wallet cards can be found in the commercial video forgetting can be awesome. wallet cards the "add to samsung wallet" service is an open platform that supports offering various types of content such as wallet cards. we are streamlining service integration with content providers across different regions and adding useful features. boarding pass event ticket loyalty gift card coupon id card generic card pay as you go (in progress) reservation (in progress) digital key (in progress) notice generic card supports unstructured forms of cards. be a samsung wallet partner partner onboarding to begin offering content through samsung wallet, you must first register as a partner on the samsung wallet partner portal. the integration process is detailed on the samsung developer portal. to join the samsung wallet partner portal, create a samsung account that is used as the service administrator. wallet card management once enrolled, you can create service cards on the wallet cards menu. each card is assigned a card id representing the service, and you can set the card type and linking information. you can manage cards according to their status – test or live. configuring wallet card notice after completing all required forms for the wallet card, click the launch button to request card activation. before providing the service to actual users, remember to turn off the 'test mode.' how to safely secure user data key generation and certificate request the registration process includes certificate exchange to securely transmit service data. refer to the diagram and developer guide, security key & certificate creation guide, to complete the certificate registration and partner enrollment smoothly. certificates exchange process ensuring data security to prevent forgery and leakage of user card data, secure tokenization processing is required. json web token (jwt), which includes encryption and signature, has a validity time basis for verification, thus providing enhanced security. in particular, when generating this token, the key and certificate previously obtained through the certificate exchange process are used. process of generating and verifying security tokens notice depending on how partners provide content services to users, you can choose how to deliver data to the samsung wallet service. two ways to transfer wallet card data add to samsung wallet interface provides two methods for partners to deliver users digital content as wallet cards. data transmit link the general way to transfer wallet card data is to organize tokenized data in the link attached to the button, and the card data is transmitted to the samsung wallet service when the user clicks the button. as long as samsung wallet support is confirmed, you can generate a link containing the user's card data and configure the "add to samsung wallet" button to run the link when pressed, either on an application or web page. data transmit process data fetch link another method to transfer wallet card data is to include only the refid, which represents the user's content, in the "add to samsung wallet" link and transmit it to the samsung wallet service. when a user clicks the "add to samsung wallet" button, samsung servers refer to the get card data api information set on the wallet card and retrieve user content using the received refid to complete registration. data fetch process this method is suitable for providing user's data through email or mms messages where static links cannot be avoided. there is an option to secure these static links. data fetch process for static links setting up data synchronization on the partner portal, you can set up the wallet card information and configure the server interaction api that the content provider needs to prepare. this api is an interface for managing card registrations, deletions, information, and state changes to sync with those registered on samsung wallet. register wallet cards when a user card is added to samsung wallet, samsung wallet servers use the send card state api to communicate card registration and deletion status to the content provider, allowing them to manage content that needs to be synchronized with samsung wallet. when a wallet card is registered, added event is sent to the partner's server update wallet cards changes to the synchronization target content can be notified to the samsung wallet service through the update notification api. here, the value that distinguishes each piece of content is the refid that the partner must provide when registering the users’ wallet card. through the get card data api, samsung wallet servers can check the latest content information any time. if updates occur on the partner's side, updated event notifications should be sent to the samsung server in case users withdraw content from the partner's side in case users delete cards from samsung wallet notice both servers should verify requests using the authorization header of the api request. this authorization token is in jwt format, familiar from card data security. effortless wallet card registration with just one click this feature is primarily composed of a link-connected button and can be provided through the content provider's application, web page, email, or mms message. various service channels javascript library for web developers we provide a javascript library and a user guide, implement the button, to help integrate your web pages. creating buttons and links in your app for configuring buttons in applications, utilize the button image resources. providing services via mms, email, or qr codes to provide services through fixed links, check out the details of the data fetch link. these static links can also be used by scanning qr codes. experience the service and practice you can experience service integration development using the codelab and use the testing tool to preregister the wallet cards created on the partner portal, which could be helpful. conclusion we've looked at how to provide digital content through the "add to samsung wallet" feature. we continuously update the guides on the developer portal, so please refer to them when preparing for integration. summary the "add to samsung wallet" service welcomes participation from content service partners and developers. for inquiries or technical support, please contact us through the form provided on the developer portal. i hope this post has been helpful, and now i'll conclude my writing here. thank you. this post was written based on the sdc23 korea session.

Choi, Jonghwa

https://developer.samsung.com/wallet/blog/en-us/2024/04/23/get-started-with-add-to-samsung-wallet

Connect Samsung Developer Conference

web

SDC23 | Cheering Together with Emoticons and Enjoyable Events While Watching Sports

sports cheer together lets you move beyond just watching tv, by providing experience that family and others can share while watching sports, through cheering emoticons and co-participating in events according to the cheering mood. we are planning to auto-generate emoticons with the user's voice to provide them with more ways to express enjoyment. back to list

https://developer.samsung.com/conference/sdc23/tech-square/cheering-together-with-emoticons-and-enjoyable-events-while-watching-sports

featured health, design, galaxy watch

blog

Prime Time Design: Unpacking the Creative Process with Pedro Machado from Health Face

sports and daily life that many users can identify with and use to get the information they need. what was the inspiration for your most successful watch face and how did you make it a reality? i remember being inspired to create one of my most successful watch faces at the sdc19 conference in san josé, california. there was a prototype car with some very striking speed markers that gave me the idea to design a watch face with similar markers – i also thought it would contrast well with smart devices. health face nº58 how do you strike a balance between the vision you have for a watch face and its functionality? is this the most challenging part of the design process? i agree that this part is the most challenging, since sometimes an idea is difficult to translate to the screen. plus, there’s the added consideration of the user. if they have vision problems, they might need larger letters and numbers, and this can pose a challenge to your original idea. to achieve a good balance between the initial idea and the final product, it’s important from the beginning to think about all the possible errors or obstacles you may encounter with your design. that way, if any problem arises, they will likely be small and easy to solve. how do you navigate guidelines without compromising the integrity of your design? when you’re starting out, it’s impossible to know all the restrictions. you must be patient with yourself and learn from your experiences. eventually you’ll learn how to navigate those guidelines and create great designs. what’s the one piece of advice you’d give a designer who is stuck in a creative rut? my advice to a designer who can’t think of a new design is to not get overwhelmed by the lack of inspiration. i recommend disconnecting for an afternoon. go outside, play a sport, relax and clear your mind to help free space for new ideas. the world around us is constantly sending signals and clues to make new designs, so take advantage of it! thanks to pedro for sharing helpful advice on the design process, staying creative and finding inspiration for galaxy watch face designs. you can connect with pedro and health face on instagram, twitter, and facebook. designers, are you ready to take the next step and sell your work on samsung devices? submit your galaxy watch faces or themes portfolio before the submission window closes on february 23rd. stay tuned for the final installment in our ‘prime time design’ series featuring ramon campos from friss in motion and follow us on twitter at @samsung_dev for our latest updates.

https://developer.samsung.com/sdp/blog/en-us/2021/02/10/prime-time-design-unpacking-the-creative-process-with-pedro-machado-from-health-face

Distribute Galaxy Store

doc

Infringement Checklist

sports and media • professional and nonprofessional sports club content such as names, logos, designs, colors • professional and non-professional sports league content such as fifa, world cup, and olympic names, logos, designs, colors • sports player content such as names, signatures, likenesses, and persona elements • movie, television show, game guide, and fan-made content such as names and images • media celebrity content such as names, signatures, likenesses, and persona elements physical products • physical products such as automobiles, motorcycles, cameras, handbags that present company brand identifiers note physical products that do not present brand identifiers are allowed without agreements architecture • privately funded buildings with ip rights such as dubai creek tower, illuminated eiffel tower note content of public or privately funded buildings visible in the background of a public space that do not imply an association with the app are allowed without agreements galaxy store badge tags • galaxy store badge tags that contain brand names, even brand names that are common public words such as band-aid and velcro miscellaneous • references to applications such as app names in the titles and descriptions of other apps • peer-to-peer p2p applications • images from stock image websites or companies • recently filmed works and creations based on those works not allowed without proof applications with the following content cannot be accepted when seller portal registration does not include the specified proof documentation • content that can imply an application or its registering individual or entity has a relationship with or an endorsement by samsung must have proof there is a relationship or endorsement such as winning a samsung developer conference award • non-common public domain content must have proof of being in the public domain references https //helpx adobe com/kr/stock/contributor/help/known-image-restrictions html https //en m wikipedia org/wiki/generic_trademark https //en wikipedia org/wiki/universal_copyright_convention https //en wikipedia org/wiki/berne_convention http //wiki gettyimages com/ https //www wipo int/branddb/en/index jsp# https //www nolo com/legal-encyclopedia/copyright-architectural-photos html

https://developer.samsung.com/galaxy-store/ip-infringement.html

Connect Samsung Developer Conference

web

SDC22 | Creating spectacular Galaxy game audio experiences with Dolby Atmos

sports games – will also share how dolby atmos benefitted their game and you will find out how dolby supports game developers and other activities on our website. speakers john couling dolby laboratories matthew reyes dolby laboratories

https://developer.samsung.com/conference/sdc22/sessions/creating-spectacular-galaxy-game-audio-experiences-with-dolby-atmos

Develop Galaxy Watch for Tizen

doc

FAQ

faq q01 why are my watch apps not available in the galaxy store for upgraded gear watches or new devices? you must specify in seller portal that your binary is compatible with all new devices a watch with an upgraded os is considered a new device and republish your app after your updated app is published, it will be available to those new devices on gear s3 and gear sport watches, the tizen os can be upgraded gear s3 can be upgraded from tizen 2 3 2 to tizen 3 0 or 4 0 gear sport can be upgraded from tizen 3 0 to tizen 4 0 if you published your app before these upgrades were available, the option to include the upgraded watch as a compatible device was not available in seller portal for example, if you published your app before tizen 4 0 was released, your selections for compatible gear sport watches in seller portal would have been for tizen 3 0 only likewise, your selections for compatible gear s3 devices would have been for tizen 2 3 2 and 3 0 as a result, a customer who has upgraded their watch to tizen 4 0 will not be able to view your app in the galaxy store in order to have your watch app recognized as compatible with an upgraded watch, you must update the compatible devices for the binary in seller portal in general, if a new device is released or an existing device becomes upgradable to a new os after you have published your app and you want your app available on these devices, you must update your binary to be compatible with these devices and republish your app to update the list of compatible devices for your binary file in seller portal log in to seller portal and open your watch face app click the binary tab at the top of the binary section, in the middle is a box with selected device s and the total number of selected compatible devices click on the number in the detailed device settings window, select each device with which the binary is compatible if your binary is compatible with all listed devices, click select all click save submit your app for validation and, after it has been successfully validated, republish it q02 create product images for galaxy watch detail pages make your galaxy watch face or app stand out in the galaxy store samsung recommends that you use portrait-orientation product images for your galaxy watch detail page users can just tap on a portrait image to open it in full-screen mode, creating an optimal phone experience and allowing your app to stand out in the galaxy store best practices use detailed, close-up images of the product we suggest that you use just the product and logo with minimal or no text for a strong image that shows the quality of your workmanship avoid using identical images for the icon, cover image, and screenshot in this case, the detail page shows three duplicate images rather than three separate views of the product screenshot resolution we suggest the following resolution guidelines for screenshots cover image = 1024 x 500 pixels horizontal screenshots = 1500 x 750 pixels vertical screenshots = 550 x 1100 pixels galaxy store asset creator you can use the galaxy store asset creator to easily export the assets you need to publish your watch face to the galaxy store to use this tool, you need photoshop version 16 0 cc 2015 or later a basic understanding of photoshop download the galaxy store watch asset creator template to get started! lifestyle photo asset packs show off your watch face designs on an actual watch using our "smart" photoshop files download lifestyle photo assets and save time! examples the following screenshot shows a galaxy watch detail page with three portrait screenshots that show detailed aspects of the galaxy watch face the following screenshot shows a galaxy watch detail page with landscape screenshots that are cut off on the sides, making them less visually appealing in the galaxy store q03 find, download, and export galaxy watch images use the lifestyle photo assets to show your watch face designs on an actual watch or, use the galaxy store asset creator to easily export the assets you need to publish your watch face to the galaxy store to use these tools, you need photoshop version 16 0 cc 2015 or later a basic understanding of photoshop download lifestyle photo assets and save time! download the galaxy store watch asset creator template to get started! q04 develop galaxy watch faces with galaxy watch studio you can use galaxy watch studio formerly galaxy watch designer to design your galaxy watch faces to download galaxy watch studio gws , go to /galaxy-watch-tizen/studio/overview html to develop watch faces using gws, see the galaxy watch studio tutorial q05 what is a distributor certificate and how is it used? the distributor certificate is used for signing and verifying your app it identifies the distributor for example, galaxy store and grants privileges to that distributor for testing purposes, it ensures that your signed application is installed on registered devices only in order to test your app on a device, the device must be registered in your personal distributor certificate then, you must build your app, which signs the app using your personal distributor certificate to generate a personal distributor certificate and register a samsung device, using the galaxy watch studio formerly galaxy watch designer , from the main menu bar, click project > distribute certificate for more information, see get your certificates using tizen studio, from the main menu bar, click tizen tools > certificate manager the samsung certificate extension must be installed in order to properly generate a personal distributor certificate for your samsung device for information about the samsung certificate extension, see installing certificate extension for information about the certificate manager, see creating certificates and managing certificate profile the personal distributor certificate is used for testing only when you release your app for sale in the galaxy store, your personal distributor certificate is replaced by an official distributor certificate if you upgrade a registered device for example, you upgrade the tizen os , you may need to re-register the device in your personal distributor certificate for example, if you upgrade your galaxy watch 3 or sport watch to tizen 4 0, you must re- register the device in your personal distributor certificate and rebuild your app before testing it on the device you may encounter one of the following error messages if there is a problem with the distributor certificate message message solution account in device profile mismatch with distributor certificate the device has been upgraded and the duid device unique identifier has changed re-register the device in your personal distributor certificate and rebuild your app launching appmanagerappid has encountered a problem the device is not found in your personal distributor certificate or your personal distributor certificate was not created properly register the device in your personal distributor certificate or re-create your personal distributor certificate and rebuild your app the application installation on the device has failed due to a signature error! error code -12 you used the tizen studio distributor certificate when building your app, not the distributor certificate generated by the samsung certificate extension select or create a distributor certificate for your samsung device using the certificate manager and rebuild your app for information about the samsung certificate extension, see installing certificate extension for information about the certificate manager, see creating certificates and managing certificate profile for more information about distributor certificates, see getting the certificates q06 how to test galaxy watch app in different devices? you can register up to 50 devices to one samsung certificate see creating certificates for more information developer certificate is made of author certificate and distributor certificate to change or add a new device to the certificate, you need to create a new distributor certificate again while keeping the same author certificate for more information, see managing certificate profile q07 what is the deeplink format to redirect users to download android app programmatically from inside galaxy watch app? linking to galaxy app store use the format below to deeplink directly to an app’s detail page, where users can see app description, screen shots etc and then install it to create a link, you need to know app’s fully qualified package name which is declared in android manifest file for android app or config xml / tizen manifest file for galaxy watch app from a galaxy watch app to android app’s store detail page samsungapps //productdetail/ example, samsungapps //productdetail/com example androidapp from a galaxy watch app to galaxy watch app’s store detail page samsungapps //productdetail/ example, samsungapps //productdetail/cnam8ugvz8 from a web site http //apps samsung com/gear/appdetail as?appid= example, http //apps samsung com/gear/appdetail as?appid=cnam8ugvz8 q08 how to update the tau library to the latest version? you can download the latest version of the tau library from downloading tau q09 how to launch android app from a galaxy watch app programmatically? see remote app control q10 when the time zone is changed, the value of the date object constructed in the callback keeps the time zone unchanged for example function test { var now = new date ; console log "hour "+now gethours ; // even when the time zone is changed, it remains unchanged } setinterval function {test ;}, 1000 ; to solve the problem, please see retrieving date and time q11 how to install my galaxy watch application to the device? see testing your app on galaxy watch if your device is galaxy watch s or older, there are 2 ways of transferring your application wgt to galaxy watch device first way is, create an android application -> copy your wgt file to assets folder of the android application -> generate apk -> install this apk through galaxy watch manager to your galaxy watch device second way is, go to command prompt -> go to the directory where the sdb exe tool is located -> make sure your wgt file is in this directory -> type command sdb install wgt q12 how to create an integrated/linked application? the integrated and linked type are deprecated on any samsung watch running tizen 2 3 1 or higher such as gear s2, gear s3, gear sport, and any galaxy watch and are only supported on gear 2, gear s, or any samsung watch running tizen 2 2 or earlier see the video how to create a basic integrated gear application q13 does gear 2 support native applications development? no it is available from the gear s2 based on the tizen 2 3 1 q14 i want to post notifications from my application to the galaxy watch device do i need to create a tizen application for this purpose? no, it is not necessary to create a galaxy watch app to send notifications from your phone every notification that the phone receives is automatically relayed to your galaxy watch device after you enable this functionality in samsung galaxy watch settings q15 does remote test lab support galaxy watch application testing? yes, more information can be found at about remote test lab q16 how do i specify meta data master_app_samsungapps_deeplink? see configuring galaxy watch application q17 where can i find tutorials for galaxy watch application development on the wearable side? see creating your first app q18 i have implemented tizen notification api in my app why are notifications posted by my app not shown in the notification panel of my galaxy watch? notification settings of a galaxy watch can be managed from the galaxy wearable app on your phone if your watch is paired to a phone, check the notification settings in the galaxy wearable app for example, in the galaxy wearable app, you can enable or disable permission for your app to send notifications to your watch also check if "show only when wearing" is enabled if this setting is enabled, notifications won't appear unless you are wearing the watch q19 can i launch the tizen emulator on a system that runs on an amd processor? no, hyper-v/whpx is not supported by amd processors instead, deploy your project directly on your galaxy watch q20 any tips and trick when connecting my galaxy watch to tizen studio? yes, consider the following the pc and watch must be on the same network developer options must be enabled on the watch galaxy watch only supports one sdb connection at a time the watch cannot connect to two different systems that are running tizen studio at the same time see testing your app on galaxy watch for more information q21 do i have to connect my galaxy watch to my pc when i deploy my app from tizen studio? yes, in order to deploy your app from tizen studio to your watch, your watch must be connected to your pc you can connect your watch over wifi

https://developer.samsung.com/galaxy-watch-tizen/faq.html

events uiux, design, mobile, galaxy watch, marketplace

blog

SDC22: Nicolás Castro from Bergen Fondly Remembers SDC2018

sports, such as biking, running, cross training, kart races, paragliding jumps, surfing, and playing football. the feeling of those styles is for active people! and of course, for those who want to experience energy 😊 this year, as the previous year, sdc will be a virtual event on october 12. what are you hoping to learn more about this year? this year i am very interested in continuing to learn about nfts as much as teaching people worldwide to create profitable watch faces. regarding nfts, i think there are many possibilities for many people, and it would be great if samsung put some eyes into it too—who knows, create a new side business in the virtual world. can you share where we see more of your work? gladly, here you go! galaxy store (mobile devices only) instagram facebook https://www.facefy.org thank you for your time today, nicolás. perhaps in a future time, we can all meet in person again. hey eric, for sure! i love flying and traveling to the us occasionally, so i will gladly meet you again. thanks for your "buena onda" (good vibes and energy), as always. resources for sellers at galaxy store many thanks to nicolás for sharing his experiences with us. nicolás is one of the many entrepreneurs all over the world whose businesses are enabled by galaxy store. for more information on signing up and selling on galaxy store, look into the galaxy store documentation. for assistance with setting up and starting your sales campaigns, the galaxy store discussion forums are where you can get great insights from other sellers. we look forward to sdc 2022 on october 12. join us online to watch the keynote and learn in the technical sessions at samsungdeveloperconference.com. join us on twitter, facebook, linkedin, and youtube to continue the discussion.

Eric Cloninger

https://developer.samsung.com/sdp/blog/en-us/2022/10/03/sdc22-nicols-castro-from-bergen-fondly-remembers-sdc2018

events mobile, iot, ai, smarttv

blog

CES 2019: Something For Everyone, No Matter How You Slice It

sports: the new playground for marketers. not only was i inspired by kristen and kristin, two amazing women blazing trails in a male-dominated industry, i was excited to hear about how esports are gaining traction with corporate sponsors. whether it’s ninja and fortnite on the galaxy note9 or the first deal between an esports league and a global sports merchandising company (overwatch league and fanatics), esports are here to stay. it won’t be long until kids are dressing up for halloween -- not as drew brees or dak prescott -- but as their favorite professional gamer. as a side note, i was amused to hear that twitch has a feature that allows others to broadcast over top of existing twitch streamers ala mst3k. also, on tuesday was a great session on the smart venue. the panelists talked about how professional sports venues are becoming more integrated into their communities, offer more than just watching the game or event, and leverage a variety of mobile and iot technologies to do more for fans. from getting concessions delivered directly to your seat to being able to place micro bets as the game progresses, teams are seeing new ways to engage the audience (as well as drive revenue for venue owners). wednesday brought a keynote session on the new mobility revolution. while the secretary of transportation was unable to attend due to the shutdown, the panel did not disappoint. bolstered by the launch of partners for automated vehicle education (pave), the automotive industry is leading the way to educate the public ahead of legislation (as it has done in the past around seat belts and air bags). as car manufacturers add to the load for drivers with the integration of voice assistants and the ability to connect to and control the smart home, it’s becoming more and more important to automate some of the traditional aspects of driving. one of the stats cited during the talk was that more than 40% of drivers have been surprised by something their car did -- and this was not solely drivers of automated driving vehicles. we need to better educate the public on the capabilities of vehicles and their included safety measures. i also had a chance to attend a dinner hosted by hackster, kickstarter, and dragon innovation. i was inspired by the stories from not impossible labs and encourage anyone interested in how technology can benefit humanity to apply for this year’s not impossible awards. i also enjoyed meeting the teams from re3d and mycroft. re3d was a finalist in richard branson’s extreme tech challenge and flew a student from michigan tech out to vegas for the event. spending time at dinner with these innovators inspired me about what future generations are building. earlier in the week, i attended exploring technology and advanced materials innovation in space based on my personal passion around human space travel. i think the biggest takeaway that i can pass on to all of you is that your technology may be used outside of its original intentions. most designers assume that gravity is present; in the future, that may not always be the case. you may have designed a solution assuming an experienced technician would be readily able to service the device, yet most techs do not have their own rockets, so it may be someone in low earth orbit that has to conduct repairs and maintenance themselves. admittedly, it might be tough to predict such a specific use case, but looking ahead (or up) may benefit your product in unexpected ways. finally, while samsung announced a number of its own robots, i was quite intrigued by breadbot. while i did not get a chance to taste a fresh-baked loaf myself, i felt the wilkinson baking company really rose to the occasion by showing a product that admittedly costs a lot of dough, but is able to deliver on-the-spot gratification to those in knead. while some ideas at ces might be half-baked, breadbot certainly is not. perhaps we’ll see it in the near future at a smart venue while we watch esports on the wall.

Lori Fraleigh

https://developer.samsung.com/sdp/blog/en-us/2019/01/14/ces-2019-something-for-everyone-no-matter-how-you-slice-it

tutorials

blog

How to Use Sensors on a Galaxy Watch

many tizen .net developers have asked how to use sensor features on a galaxy watch. this blog introduces sensors that are supported for galaxy watch and how developers can use them. environment target devices the following samsung wearables can be used with the tizen.net nuget package: galaxy watch galaxy watch active gear s3 (4.0 or later) gear sport (4.0 or later) the accelerometer, barometer, gyro, hr, and light sensors are supported. tizen .net nuget package to use sensor features on galaxy watch and other wearable applications, refer to the tizen.net nuget package. the tizen.wearable.circularui provides the xamarin.forms extension controls, which are used for wearables. <packagereference include="tizen.wearable.circularui" version="1.1.0" /> apis the tizen.net nuget package contains the tizen.sensor namespace, which provides the sensor api. in the following table, find the api class that matches the sensor you want to use: sensor name class name accelerometer accelerometer barometer pressuresensor gyro gyroscope hr heartratemonitor light lightsensor usage declare namespace. using tizen.sensor; create instance. new accelerometer(); use sensor. accelerometer.issupported; //properties accelerometer.count; accelerometer.start(); //method accelerometer.stop(); accelerometer.dataupdated += (s, e) => { }; //event example the following example shows how to use the accelerometer on the application: using tizen.sensor; using tizen.wearable.circularui.forms; public class accelerometerpage : circlepage { public accelerometer accelerometer { get; private set; } public accelerometerpage() { if (accelerometer.issupported && accelerometer.count) { accelerometer = new accelerometer(); accelerometer.dataupdated += (s, e) => { // use event argument }; } } protected override void onappearing() { base.onappearing(); accelerometer?.start(); } protected override void ondisappearing() { base.ondisappearing(); accelerometer?.stop(); } } checking permission for hr sensor for hr sensors, the developer needs to declare privilege and check permission. refer to privacy-related permissions and the following sample code. declaring privilege: http://tizen.org/privilege/healthinfo checking permission in your app code. using tizen.security; using tizen.sensor; using tizen.wearable.circularui.forms; public partial class hrmpage : circlepage { private const string hrmprivilege = "http://tizen.org/privilege/healthinfo"; public hrmpage() { checkresult result = privacyprivilegemanager.checkpermission(hrmprivilege); switch (result) { case checkresult.allow: createhrm(); break; case checkresult.deny: break; case checkresult.ask: privacyprivilegemanager.requestpermission(hrmprivilege); break; } } } demo we provide several sample applications for wearables here, including the sensor sample used in this post. if you have any questions about how to configure and use sensors on galaxy watch apps, use issues to contact us.

Sungsu Kim

https://developer.samsung.com/tizen/blog/en-us/2019/04/15/how-to-use-sensors-on-a-galaxy-watch

Distribute Galaxy Store

doc

Guidelines

sports performance in mind? check out my health watch which features step counts, heart rate, moving distance indicator, weather, and more time format and colors are customizable and it’s battery friendly!watch face name -> my health watchwatch face link-> https //galaxy store/myhealthwatch#galaxywatch #watchfaces

https://developer.samsung.com/galaxy-store/social-promotion.html

Didn’t find what you were looking for?

FAQ

Search frequently asked
questions
by keywords.

Join the Forum

Visit the Forum to ask
questions and exchange
ideas with other developers.

Get Support

Submit a 1:1 Support request
and receive a response
within 2 business days.

Preferences Submitted

You have successfully updated your cookie preferences.